- Recombinant Methanosarcina mazei Tetrahydromethanopterin S-methyltransferase subunit F (mtrF)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1003001
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 7,568 Da
- E Coli or Yeast
- 26330
- Tetrahydromethanopterin S-methyltransferase subunit F (mtrF)
Sequence
AEEHEKGVPMVLAPQMGAIDATVESIRYRAQLIARNQKLDSGVAATGIIGFAAGFLFSLLMVIVLPVAVGL